HPA020659

SLCO2B1 antibody from Sigma-Aldrich
OATP-B, OATP2B1, SLC21A9
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA020659
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA020659, RRID:AB_1857219
Product name
Anti-SLCO2B1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA020659
Antibody type
Polyclonal
Antigen
Solute carrier organic anion transporter family member 2B1 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
GITHQTSAHPGLELSPSCMEACSCPLDGFNPVCDP
STRVEYITPCHAGCSSWVVQDALDNSQVFYTNCSC
VVEGNPVLAGSCDSTCSHLVVPF
Storage
-20C
Provider Type Product Number
- No reagents -