HPA023676

NCDN antibody from Sigma-Aldrich
NCDN-1, NCDN-2
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA023676
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA023676, RRID:AB_1854325
Product name
Anti-NCDN antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA023676
Antibody type
Polyclonal
Antigen
Neurochondrin recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
PEYEGIWADLQELWFLGMQAFTGCVPLLPWLAPAA
LRSRWPQELLQLLGSVSPNSVKPEMVAAYQGVLVE
LARANRLCREAMRLQAGEETASHYRMAA
Storage
-20C
Provider Type Product Number
- No reagents -