HPA006238

TMPRSS4 antibody from Sigma-Aldrich
MT-SP2, TMPRSS3
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA006238
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA006238, RRID:AB_1080316
Product name
Anti-TMPRSS4 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA006238
Antibody type
Polyclonal
Antigen
Transmembrane protease, serine 4 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
DVFNWKVRAGSDKLGSFPSLAVAKIIIIEFNPMYP
KDNDIALMKLQFPLTFSGTVRPICLPFFDEELTPA
TPLWIIGWGFTKQNGGKMSDILLQASVQVIDSTRC
NADDAYQGEVTEKMM
Storage
-20C
Provider Type Product Number
- No reagents -