HPA011337

CASP6 antibody from Sigma-Aldrich
MCH2
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA011337
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA011337, RRID:AB_1846053
Product name
Anti-CASP6 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA011337
Antibody type
Polyclonal
Antigen
Caspase-6 precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
DVPVIPLDVVDNQTEKLDTNITEVDAASVYTLPAG
ADFLMCYSVAEGYYSHRETVNGSWYIQDLCEMLGK
YGSSLEFTELLTLVNRKVSQRRVDFCKDPSAIGKK
QV
Storage
-20C
Provider Type Product Number
- No reagents -