HPA024303

CASP6 antibody from Sigma-Aldrich
MCH2
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA024303
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA024303, RRID:AB_1846052
Product name
Anti-CASP6 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA024303
Antibody type
Polyclonal
Antigen
Caspase-6 Precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
MSSASGLRRGHPAGGEENMTETDAFYKREMFDPAE
KYKMDHRRRGIALIFNHERFFWHLTLPERRGTCAD
RDNLTRRF
Storage
-20C
Provider Type Product Number
- No reagents -