HPA020631

PTGES2 antibody from Sigma-Aldrich
C9orf15, FLJ14038
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA020631
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA020631, RRID:AB_1855887
Product name
Anti-PTGES2 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA020631
Antibody type
Polyclonal
Antigen
Prostaglandin E synthase 2 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
VEGAVAKYMGAAAMYLISKRLKSRHRLQDNVREDL
YEAADKWVAAVGKDRPFMGGQKPNLADLAVYGVLR
VMEGLDAFDDLMQHTHIQPWYLRVERAITEAS
Storage
-20C
Provider Type Product Number
- No reagents -