HPA020083

PNPLA8 antibody from Sigma-Aldrich
IPLA2-2, IPLA2G, iPLA2gamma
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA020083
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA020083, RRID:AB_1851849
Product name
Anti-PNPLA8 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA020083
Antibody type
Polyclonal
Antigen
Calcium-independent phospholipase A2-gamma recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
DSGWLKQKNIKQAIKSLKKYSDKSAEKSPFPEEKS
HIIDKEEDIGKRSLFHYTSSITTKFGDSFYFLSNH
INSYFKRKEKMSQQKENE
Storage
-20C
Provider Type Product Number
- No reagents -