HPA011338

C1RL antibody from Sigma-Aldrich
C1r-LP, C1RL1
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA011338
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA011338, RRID:AB_1847111
Product name
Anti-C1RL antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA011338
Antibody type
Polyclonal
Antigen
Complement C1r subcomponent-like protein precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
NVLPVCLPDNETLYRSGLLGYVSGFGMEMGWLTTE
LKYSRLPVAPREACNAWLQKRQRPEVFSDNMFCVG
DETQ
Storage
-20C
Provider Type Product Number
- No reagents -