Antibody data

Product number
H00011179-B01
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00011179-B01, RRID:AB_1116254
Product name
ZNF277 MaxPab mouse polyclonal antibody (B01)
Provider product page
Abnova Corporation - H00011179-B01
Antibody type
Polyclonal
Description
Mouse polyclonal antibody raised against a full-length human ZNF277 protein.
Antigen sequence
MQEDRDGSCSTVGGVGYGDSKDCILEPLSLPESPG
GTTTLEGSPSVPCIFCEEHFPVAEQDKLLKHMIIE
HKIVIADVKLVADFQRYILYWRKRFTEQPITDFCS
VIRINSTAPFEEQENYFLLCDVLPEDRILREELQK
QRLREILEQQQQERNDTNFHGVCMFCNEEFLGNRS
VILNHMAREHAFNIGLPDNIVNCNEFLCTLQKKLD
NLQCLYCEKTFRDKNTLKDHMRKKQHRKINPKNRE
YDRFYVINYLELGKSWEEVQLEDDRELLDHQEDDW
SDWEEHPASAVCLFCEKQAETIEKLYVHMEDAHEF
DLLKIKSELGLNFYQQVKLVNFIRRQVHQCRCYGC
HVKFKSKADLRTHMEETKHTSLLPDRKTWDQLEYY
FPTYENDTLLCTLSDSESDLTAQEQNENVPIISED
TSKLYALKQSSILNQLLL
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -