HPA027307

ZNF277 antibody from Sigma-Aldrich
NRIF4, ZNF277P
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA027307
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA027307, RRID:AB_1859164
Product name
Anti-ZNF277 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA027307
Antibody type
Polyclonal
Antigen
Zinc finger protein 277 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
FPVAEQDKLLKHMIIEHKIVIADVKLVADFQRYIL
YWRKRFTEQPITDFCSVIRINSTAPFEEQENYFLL
CDVLPEDRILREELQKQRLREILEQQQQERNDTNF
HGVCMFCNEEFLGNRSVILNH
Storage
-20C
Provider Type Product Number
- No reagents -