HPA012510

PSME3 antibody from Sigma-Aldrich
Ki, PA28-gamma, PA28G, REG-GAMMA
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA012510
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA012510, RRID:AB_1855752
Product name
Anti-PSME3 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA012510
Antibody type
Polyclonal
Antigen
Proteasome activator complex subunit 3 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
QEVKLKVDSFRERITSEAEDLVANFFPKKLLELDS
FLKEPILNIHDLTQIHSDMNLPVPDPILLTNSHDG
LDGPTYKKRRLDECEEAFQGTKVFVMPNGMLKSNQ
QLVDIIEKVKPEIRLLIEKCNT
Storage
-20C
Provider Type Product Number
- No reagents -