HPA020725

C9orf16 antibody from Sigma-Aldrich
EST00098, FLJ12823, MGC4639
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA020725
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA020725, RRID:AB_1845816
Product name
Anti-C9orf16 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA020725
Antibody type
Polyclonal
Antigen
UPF0184 protein C9orf16 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
NGDLGMPVEAGAEGEEDGFGEAEYAAINSMLDQIN
SCLDHLEEKNDHLHARLQELLESNRQTRLEFQQQL
GEAPSDASP
Storage
-20C
Provider Type Product Number
- No reagents -