HPA024122

IFRD1 antibody from Atlas Antibodies
PC4, TIS7
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA024122
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA024122, RRID:AB_1851452
Product name
Anti-IFRD1
Provider product page
Atlas Antibodies - HPA024122
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
AKVDKRKQRSVFRDVLRAVEERDFPTETIKFGPER
MYIDCWVKKHTYDTFKEVLGSGMQYHLQSNEFLRN
VFELGPPVMLDAATLK
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -