HPA024122

IFRD1 antibody from Sigma-Aldrich
PC4, TIS7
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA024122
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA024122, RRID:AB_1851452
Product name
Anti-IFRD1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA024122
Antibody type
Polyclonal
Antigen
Interferon-related developmental regulator 1 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
AKVDKRKQRSVFRDVLRAVEERDFPTETIKFGPER
MYIDCWVKKHTYDTFKEVLGSGMQYHLQSNEFLRN
VFELGPPVMLDAATLK
Storage
-20C
Provider Type Product Number
- No reagents -