Antibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- HPA019840 - Provider product page
- Provider
- Atlas Antibodies
- Product name
- Anti-SFRP5
- Antibody type
- Polyclonal
- Antigen
- Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
- Description
- Affinity purified using the PrEST antigen as affinity ligand
- Reactivity
- Human
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
LHCHKFPLDNDLCIAVQFGHLPATAPPVTKICAQC
EMEHSADGLMEQMCSSDFVVKMRIKEIKIENGDRK
LIGAQKKKKLLKP- Isotype
- IgG
- Vial size
- 100 μl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Submitted references Pro-Inflammatory wnt5a and Anti-Inflammatory sFRP5 Are Differentially Regulated by Nutritional Factors in Obese Human Subjects
Epigenetic Changes in Basal Cell Carcinoma Affect SHH and WNT Signaling Components
Sethi J, Schulte D, Müller N, Neumann K, Oberhäuser F, Faust M, Güdelhöfer H, Brandt B, Krone W, Laudes M
PLoS ONE 2012;7(2):e32437
PLoS ONE 2012;7(2):e32437
Epigenetic Changes in Basal Cell Carcinoma Affect SHH and WNT Signaling Components
Castresana J, Brinkhuizen T, van den Hurk K, Winnepenninckx V, de Hoon J, van Marion A, Veeck J, van Engeland M, van Steensel M
PLoS ONE 2012;7(12):e51710
PLoS ONE 2012;7(12):e51710
No comments: Submit comment
No validations: Submit validation data