HPA019840

SFRP5 antibody from Sigma-Aldrich
SARP3
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA019840
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA019840, RRID:AB_1856779
Product name
Anti-SFRP5 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA019840
Antibody type
Polyclonal
Antigen
Secreted frizzled-related protein 5 Precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
LHCHKFPLDNDLCIAVQFGHLPATAPPVTKICAQC
EMEHSADGLMEQMCSSDFVVKMRIKEIKIENGDRK
LIGAQKKKKLLKP
Storage
-20C
Provider Type Product Number
- No reagents -