Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN970970 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Interferon Regulatory Factor 2 (IRF2) (N-Term) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-IRF2 antibody: synthetic peptide directed towards the N terminal of human IRF2
- Description
- Affinity Purified
- Reactivity
- Human, Mouse, Rat, Bovine, Canine, Chicken/Avian, Porcine, Xenopus, Zebrafish
- Host
- Rabbit
- Antigen sequence
APLFRNRAIHTGKHQPGVDKPDPKTWKANFRCAMN
SLPDI EEVKDKSIKK- Epitope
- N-Term
- Vial size
- 50 μg
- Storage
- Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen. For longer periods of storage, store at -20°C
Submitted references Interferon regulatory factor 1 (IRF-1) and IRF-2 distinctively up-regulate gene expression and production of interleukin-7 in human intestinal epithelial cells.
Oshima S, Nakamura T, Namiki S, Okada E, Tsuchiya K, Okamoto R, Yamazaki M, Yokota T, Aida M, Yamaguchi Y, Kanai T, Handa H, Watanabe M
Molecular and cellular biology 2004 Jul;24(14):6298-310
Molecular and cellular biology 2004 Jul;24(14):6298-310
No comments: Submit comment
No validations: Submit validation data