HPA020389

TMEM168 antibody from Sigma-Aldrich
DKFZp564C012, FLJ13576
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA020389
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA020389, RRID:AB_1858101
Product name
Anti-TMEM168 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA020389
Antibody type
Polyclonal
Antigen
Transmembrane protein 168 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
VLDSENSTPWVKEVRKINDQYIAVQGAELIKTVDI
EEADPPQLGDFTKDWVEYNCNSSNNICWTEKGRTV
K
Storage
-20C
Provider Type Product Number
- No reagents -