Antibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- HPA006376 - Provider product page
- Provider
- Atlas Antibodies
- Product name
- Anti-TGFB1I1
- Antibody type
- Polyclonal
- Antigen
- Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
- Description
- Affinity purified using the PrEST antigen as affinity ligand
- Reactivity
- Human, Mouse, Rat
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
AGQVVTALGRAWHPEHFVCGGCSTALGGSSFFEKD
GAPFCPECYFERFSPRCGFCNQPIRHKMVTALGTH
WHPEHFCCVSCGEPF- Isotype
- IgG
- Vial size
- 100μl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Submitted references Systematic validation of antibody binding and protein subcellular localization using siRNA and confocal microscopy
The interactome of LIM domain proteins: The contributions of LIM domain proteins to heart failure and heart development
Stadler C, Hjelmare M, Neumann B, Jonasson K, Pepperkok R, Uhlén M, Lundberg E
Journal of Proteomics 2012;75(7):2236-2251
Journal of Proteomics 2012;75(7):2236-2251
The interactome of LIM domain proteins: The contributions of LIM domain proteins to heart failure and heart development
Li A, Ponten F, dos Remedios C
PROTEOMICS 2012;12(2):203-225
PROTEOMICS 2012;12(2):203-225
No comments: Submit comment
No validations: Submit validation data