HPA006376

TGFB1I1 antibody from Sigma-Aldrich
ARA55, Hic-5, TSC-5
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA006376
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA006376, RRID:AB_1079056
Product name
Anti-TGFB1I1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA006376
Antibody type
Polyclonal
Antigen
Androgen receptor coactivator ARA55 isoform 2 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
AGQVVTALGRAWHPEHFVCGGCSTALGGSSFFEKD
GAPFCPECYFERFSPRCGFCNQPIRHKMVTALGTH
WHPEHFCCVSCGEPF
Storage
-20C
Provider Type Product Number
- No reagents -