HPA006314

PARN antibody from Sigma-Aldrich
DAN
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA006314
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA006314, RRID:AB_1079567
Product name
Anti-PARN antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA006314
Antibody type
Polyclonal
Antigen
Poly(A)-specific ribonuclease PARN recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
DGEFSGISDGPSVSALTNGFDTPEERYQKLKKHSM
DFLLFQFGLCTFKYDYTDSKYITKSFNFYVFPKPF
NRSSPDVKFVCQSSSIDFLASQGFDFNKVFRNGIP
YLNQEEERQLREQYDEKRSQANGAGA
Storage
-20C
Provider Type Product Number
- No reagents -