HPA003113

WDR25 antibody from Atlas Antibodies
C14orf67, MGC4645
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA003113
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA003113, RRID:AB_2215263
Product name
Anti-WDR25
Provider product page
Atlas Antibodies - HPA003113
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
LVAYDDSDSEAETEHAGSFNATGQQKDTSGVARPP
GQDFASGTLDVPKAGAQPTKHGSCEDPGGYRLPLA
QLGRSDRGSCPSQRLQWPGKEPQVTFPIKEPSCSS
LWTS
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -