HPA003113

WDR25 antibody from Sigma-Aldrich
C14orf67, MGC4645
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA003113
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA003113, RRID:AB_2215263
Product name
Anti-WDR25 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA003113
Antibody type
Polyclonal
Antigen
WD repeat protein 25 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
LVAYDDSDSEAETEHAGSFNATGQQKDTSGVARPP
GQDFASGTLDVPKAGAQPTKHGSCEDPGGYRLPLA
QLGRSDRGSCPSQRLQWPGKEPQVTFPIKEPSCSS
LWTS
Storage
-20C
Provider Type Product Number
- No reagents -