HPA005758

ZSCAN32 antibody from Atlas Antibodies
FLJ20417, ZNF434
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA005758
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA005758, RRID:AB_1080720
Product name
Anti-ZSCAN32
Provider product page
Atlas Antibodies - HPA005758
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
GEEAVALVEDVQRAPGQQVLDSEKDLKVLMKEMAP
LGATRESLRSQWKQEVQPEEPTFKGSQSSHQRPGE
QSEAWLAPQAPRNLPQNTGLH
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -