HPA005758

ZSCAN32 antibody from Sigma-Aldrich
FLJ20417, ZNF434
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA005758
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA005758, RRID:AB_1080720
Product name
Anti-ZNF434 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA005758
Antibody type
Polyclonal
Antigen
Zinc finger protein 434 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
GEEAVALVEDVQRAPGQQVLDSEKDLKVLMKEMAP
LGATRESLRSQWKQEVQPEEPTFKGSQSSHQRPGE
QSEAWLAPQAPRNLPQNTGLH
Storage
-20C
Provider Type Product Number
- No reagents -