HPA027461

TEKT2 antibody from Sigma-Aldrich
TEKTB1
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA027461
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA027461, RRID:AB_10600912
Product name
Anti-TEKT2 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA027461
Antibody type
Polyclonal
Antigen
tektin 2 (testicular) recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
HQIRQEARVLRNETNNQTIWDEHDNRTRLVERIDT
VNRWKEMLDKCLTDLDAEIDALTQMKESAEQNLQA
KNLPLDVAIECLTLRESRRDIDVVKD
Storage
-20C
Provider Type Product Number
- No reagents -