HPA015327

GRK6 antibody from Sigma-Aldrich
GPRK6
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA015327
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA015327, RRID:AB_1850334
Product name
Anti-GRK6 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA015327
Antibody type
Polyclonal
Antigen
G protein-coupled receptor kinase 6 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
MIAGQSPFQQRKKKIKREEVERLVKEVPEEYSERF
SPQARSLCSQLLCKDPAERLGCRGGSAREVKEHPL
FKKLNFK
Storage
-20C
Provider Type Product Number
- No reagents -