HPA018903

GRK6 antibody from Atlas Antibodies
GPRK6
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA018903
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA018903, RRID:AB_1850335
Product name
Anti-GRK6
Provider product page
Atlas Antibodies - HPA018903
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
LLFREFCATRPELSRCVAFLDGVAEYEVTPDDKRK
ACGRQLTQNFLSHTGPDLIPEVPRQLVTNCTQRLE
QGPCKDLFQELTRLTHEYLSVAPFADYLDSIYFNR
FLQWKWLER
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -