HPA027104

ADPRS antibody from Atlas Antibodies
ADPRHL2, ARH3, FLJ20446

Antibody data

Product number
HPA027104
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA027104, RRID:AB_10601330
Product name
Anti-ADPRHL2
Provider product page
Atlas Antibodies - HPA027104
Antibody type
Polyclonal
Reactivity
Human, Mouse, Rat
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
SEHFLKQLLGHMEDLEGDAQSVLDARELGMEERPY
SSRLKKIGELLDQASVTREEVVSELGNGIAAFESV
PTAIYCFLR
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.