Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [2]
- Immunocytochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00007756-M01 - Provider product page
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00007756-M01, RRID:AB_509083
- Product name
- ZNF207 monoclonal antibody (M01), clone 6D6
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant ZNF207.
- Antigen sequence
MGRKKKKQLKPWCWYCNRDFDDEKILIQHQKAKHF
KCHICHKKLYTGPGLAIHCMQVHKETIDAVPNAIP
GRTDIELEIYGMEGIPEKDMDERRRLLEQKTQESQ
KKKQQ- Isotype
- IgG
- Antibody clone number
- 6D6
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- ZNF207 monoclonal antibody (M01), clone 6D6 Western Blot analysis of ZNF207 expression in Hela S3 NE ( Cat # L013V3 ).
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Western Blot analysis of ZNF207 expression in transfected 293T cell line by ZNF207 monoclonal antibody (M01), clone 6D6.Lane 1: ZNF207 transfected lysate(49.7 KDa).Lane 2: Non-transfected lysate.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Immunofluorescence of monoclonal antibody to ZNF207 on HeLa cell. [antibody concentration 10 ug/ml]
- Validation comment
- Immunofluorescence
- Protocol
- Protocol