HPA017882

CIAO1 antibody from Sigma-Aldrich
CIA1, WDR39
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA017882
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA017882, RRID:AB_1846738
Product name
Anti-CIAO1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA017882
Antibody type
Polyclonal
Antigen
Protein CIAO1 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
CSDDRTVRIWRQYLPGNEQGVACSGSDPSWKCICT
LSGFHSRTIYDIAWCQLTGALATACGDDAIRVFQE
DPNSDPQQPTFSLTAHLHQAHSQDVNCVAWNPKEP
GLLASCSDDGEVAFWKYQR
Storage
-20C
Provider Type Product Number
- No reagents -