HPA017882

CIAO1 antibody from Atlas Antibodies
CIA1, WDR39
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA017882
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA017882, RRID:AB_1846738
Product name
Anti-CIAO1
Provider product page
Atlas Antibodies - HPA017882
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
CSDDRTVRIWRQYLPGNEQGVACSGSDPSWKCICT
LSGFHSRTIYDIAWCQLTGALATACGDDAIRVFQE
DPNSDPQQPTFSLTAHLHQAHSQDVNCVAWNPKEP
GLLASCSDDGEVAFWKYQR
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -