Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [3]
- Immunocytochemistry [1]
- Immunohistochemistry [11]
Submit
Validation data
Reference
Comment
Report error
- Product number
- AMAb90730 - Provider product page
- Provider
- Atlas Antibodies
- Proper citation
- Atlas Antibodies Cat#AMAb90730, RRID:AB_2665648
- Product name
- Anti-WWTR1
- Antibody type
- Monoclonal
- Reactivity
- Human
- Host
- Mouse
- Conjugate
- Unconjugated
- Antigen sequence
MNPKPSSWRKKILPESFFKEPDSGSHSRQSSTDSS
GGHPGPRLAGGAQHVRSHSSPASLQLGTGAGAAGS
PAQQHAHLRQQSYDVTDELPLPPGWEMTFTATGQR
YFLNHIEKITTWQDPRKAMNQPLNHMNLHPAVSST- Epitope
- Binds to an epitope located within the peptide sequence SSWRKKILPESFFKE as determined by overlapping synthetic peptides.
- Isotype
- IgG
- Antibody clone number
- CL0371
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
No comments: Submit comment
Enhanced validation
- Submitted by
- Atlas Antibodies (provider)
- Enhanced method
- Genetic validation
- Main image
- Experimental details
- Western blot analysis in EFO-21 cells transfected with control siRNA, target specific siRNA probe #1 and #2, using Anti-WWTR1 antibody. Remaining relative intensity is presented. Loading control: Anti-PPIB.
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Lane 1: Marker [kDa]Lane 2: Human cell line U-251 MG
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Western blot analysis of extracts from EFO-21 cells, transfected with: control siRNA, target specific siRNA probe #1, target specific siRNA probe #2, using Anti-WWTR1 monoclonal antibody. Downregulation of antibody signal confirms target specificity. Remaining % intensity, relative control lane, is indicated. Anti-PPIB monoclonal antibody was used as loading control.
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunofluorescence staining in SKMEL cell line with Anti-WWTR1 monoclonal antibody, showing spotty nuclear staining in green. Microtubule probes are visualized in red (where available).
- Sample type
- HUMAN
Enhanced validation
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Enhanced method
- Orthogonal validation
- Main image
- Experimental details
- Immunohistochemistry analysis in human placenta and lymph node tissues using AMAb90730 antibody. Corresponding WWTR1 RNA-seq data are presented for the same tissues.
- Sample type
- HUMAN
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human breast cancer shows strong nuclear and moderate cytoplasmic immunoreactivity in tumor cells.
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human kidney shows strong nuclear combined with moderate cytoplasmic positivity in renal tubuli and glomeruli.
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human placenta shows strong immunoreactivity in trophoblast and endothelial cells.
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human testis shows nuclear positivity in a subset of cells.
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human stomach cancer shows moderate immunoreactivity in tumor cells and strong staining in the endothelium.
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human rectum shows strong positivity in a subset of lymphoid but not glandular cells.
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human breast cancer shows moderate to strong nuclear positivity in tumor cells.
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human placenta shows strong nuclear and some cytoplasmic positivity in endothelial cells.
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human kidney shows strong nuclear and moderate cytoplasmic positivity in cells in tubules and in glomeruli.
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human lymph node shows no nuclear positivity in lymphoid cells as expected.