HPA007415

WWTR1 antibody from Atlas Antibodies
DKFZp586I1419, TAZ
Validated within the Antibodypedia Validation Initative

Antibody data

Product number
HPA007415
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA007415, RRID:AB_889088
Product name
Anti-WWTR1
Provider product page
Atlas Antibodies - HPA007415
Antibody type
Polyclonal
Description
Affinity purified using the PrEST antigen as affinity ligand
Reactivity
Human, Mouse
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
MNPKPSSWRKKILPESFFKEPDSGSHSRQSSTDSS
GGHPGPRLAGGAQHVRSHSSPASLQLGTGAGAAGS
PAQQHAHLRQQSYDVTDELPLPPGWEMTFTATGQR
YFLNHIEKITTWQDPRKAMNQPLNHMNLHPAVSST
Isotype
IgG
Vial size
100 µl
Storage
Store at +4¡C for short term storage. Long time storage is recommended at -20¡C.
Provider Type Product Number
- No reagents -