Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN310529 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Solute Carrier Family 25, Member 39 (SLC25A39) (C-Term) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-SLC25A39 antibody: synthetic peptide directed towards the C terminal of human SLC25A39
- Description
- Affinity Purified
- Reactivity
- Human, Mouse, Rat, Bovine, Canine, Xenopus, Zebrafish
- Host
- Rabbit
- Antigen sequence
RVNPLHVDSTWLLLRRIRAESGTKGLFAGFLPRII
KAAPS CAIMISTYEF- Epitope
- C-Term
- Vial size
- 50 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references Overexpression of the human 2-oxoglutarate carrier lowers mitochondrial membrane potential in HEK-293 cells: contrast with the unique cold-induced mitochondrial carrier CGI-69.
Yu XX, Lewin DA, Zhong A, Brush J, Schow PW, Sherwood SW, Pan G, Adams SH
The Biochemical journal 2001 Jan 15;353(Pt 2):369-75
The Biochemical journal 2001 Jan 15;353(Pt 2):369-75
No comments: Submit comment
No validations: Submit validation data