HPA021211

TRUB2 antibody from Sigma-Aldrich
CLONE24922
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA021211
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA021211, RRID:AB_1858375
Product name
Anti-TRUB2 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA021211
Antibody type
Polyclonal
Antigen
Probable tRNA pseudouridine synthase 2 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
AFAHLKVGVGHRLDAQASGVLVLGVGHGCRLLTDM
YNAHLTKDYTVRGLLGKATDDFREDGRLVEKTTYD
HVTREKLDRILAV
Storage
-20C
Provider Type Product Number
- No reagents -