HPA017911

DDX41 antibody from Sigma-Aldrich
ABS, MGC8828
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA017911
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA017911, RRID:AB_1847558
Product name
Anti-DDX41 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA017911
Antibody type
Polyclonal
Antigen
Probable ATP-dependent RNA helicase DDX41 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
MEESEPERRRARTDEVPAGGSRSEAEDEDDEDYVP
YVPLRQRRQLLLQKLLQRRRKGAAEEEQQDSGSEP
RGDEDDIPLGPQSNVSLLDQHQHL
Storage
-20C
Provider Type Product Number
- No reagents -