HPA017911

DDX41 antibody from Atlas Antibodies
ABS, MGC8828
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA017911
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA017911, RRID:AB_1847558
Product name
Anti-DDX41
Provider product page
Atlas Antibodies - HPA017911
Antibody type
Polyclonal
Reactivity
Human, Mouse, Rat
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
MEESEPERRRARTDEVPAGGSRSEAEDEDDEDYVP
YVPLRQRRQLLLQKLLQRRRKGAAEEEQQDSGSEP
RGDEDDIPLGPQSNVSLLDQHQHL
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -