Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN183801 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Leucine Zipper, Putative Tumor Suppressor 1 (LZTS1) (C-Term) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-LZTS1 antibody: synthetic peptide directed towards the C terminal of human LZTS1
- Description
- Protein A purified
- Reactivity
- Human, Mouse, Rat, Bovine, Canine
- Host
- Rabbit
- Antigen sequence
QQSYVAMYQRNQRLEKALQQLARGDSAGEPLEVDL
EGADI PYEDIIATEI- Epitope
- C-Term
- Vial size
- 100 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references Germline sequence variants of the LZTS1 gene are associated with prostate cancer risk.
Hawkins GA, Mychaleckyj JC, Zheng SL, Faith DA, Kelly B, Isaacs SD, Wiley KE, Chang BL, Ewing CM, Bujnovszky P, Bleecker ER, Walsh PC, Meyers DA, Isaacs WB, Xu J
Cancer genetics and cytogenetics 2002 Aug;137(1):1-7
Cancer genetics and cytogenetics 2002 Aug;137(1):1-7
No comments: Submit comment
No validations: Submit validation data