HPA006294

LZTS1 antibody from Sigma-Aldrich
FEZ1
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA006294
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA006294, RRID:AB_1079288
Product name
Anti-LZTS1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA006294
Antibody type
Polyclonal
Antigen
Leucine zipper putative tumor suppressor 1 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
TEVNAKASEILGLKAQLKDTRGKLEGLELRTQDLE
GALRTKGLELEVCENELQRKKNEAELLREKVNLLE
QELQELRAQAALARDMGPPTFPEDVPALQRELERL
RAELREERQGHDQMSSGFQHERLVWKE
Storage
-20C
Provider Type Product Number
- No reagents -