HPA008723

FOXJ2 antibody from Sigma-Aldrich
FHX
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA008723
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA008723, RRID:AB_1078903
Product name
Anti-FOXJ2 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA008723
Antibody type
Polyclonal
Antigen
Forkhead box protein J2 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
ELMESLRQAEQKNWTLDQHHIANLCDSLNHFLTQT
GHVPPQGGTHRPPAPARIADSCALTSGKQESAMSQ
VNSYGHPQAPHLYPGPSPMYPIPTQDSAGYNRPAH
HMVPRPSVPPPGANEEIPDDFDWDLI
Storage
-20C
Provider Type Product Number
- No reagents -