H00136991-B01P

ASZ1 antibody from Abnova Corporation
ALP1, ANKL1, C7orf7, CT1.19, GASZ, Orf3

Antibody data

Product number
H00136991-B01P
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00136991-B01P, RRID:AB_1571491
Product name
ASZ1 purified MaxPab mouse polyclonal antibody (B01P)
Provider product page
Abnova Corporation - H00136991-B01P
Antibody type
Polyclonal
Description
Mouse polyclonal antibody raised against a full-length human ASZ1 protein.
Antigen sequence
MAASALRGLPVAGGGESSESEDDGWEIGYLDRTSQ
KLKRLLPIEEKKEKFKKAMTIGDVSLVQELLDSGI
SVDSNFQYGWTPLMYAASVANAELVRVLLDRGANA
SFEKDKQSILITACSAHGSEEQILKCVELLLSRNA
DPNVACRRLMTPIMYAARDGHTQVVALLVAHGAEV
NTQDENGYTALTWAARQGHKNIVLKLLELGANKML
QTKDGKMPSEIAKRNKHHEIFNLLSFTLNPLEGKL
QQLTKEDTICKILTTDSDREKDHIFSSYTAFGDLE
VFLHGLGLEHMTDLLKERDITLRHLLTMREDEFTK
NGITSKDQQKILAALKELQVEEIQFGELSEETKLE
ISGDEFLNFLLKLNKQCGHLITAVQNVITELPVNS
QKVFYKSY
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -