HPA020558

ASZ1 antibody from Sigma-Aldrich
ALP1, ANKL1, C7orf7, CT1.19, GASZ, Orf3
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA020558
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA020558, RRID:AB_1845123
Product name
Anti-ASZ1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA020558
Antibody type
Polyclonal
Antigen
Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
DGHTQVVALLVAHGAEVNTQDENGYTALTWAARQG
HKNIVLKLLELGANKMLQTKDGKMPSEIAKRNKHH
EIFNLLSFTLNPLEGKLQQLTKED
Storage
-20C
Provider Type Product Number
- No reagents -