PAB20959

CNNM4 antibody from Abnova Corporation
ACDP4, KIAA1592

Antibody data

Product number
PAB20959
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#PAB20959, RRID:AB_10963122
Product name
CNNM4 polyclonal antibody
Provider product page
Abnova Corporation - PAB20959
Antibody type
Polyclonal
Description
Rabbit polyclonal antibody raised against recombinant CNNM4.
Antigen sequence
FSYYGTMALTSVPSDRSPAHPTPLSRSASLSYPDR
TDVSTAATLAGSSNQFGSSVLGQYISDFSVRALVD
LQYIKITRQQYQNGLLASRMENSPQFPIDGCTTHM
ENLAEKSELPVVDETTTLLNERNSL
Isotype
IgG
Storage
Store at 4°C. For long term storage store at -20°C.Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -