HPA017732

CNNM4 antibody from Sigma-Aldrich
ACDP4, KIAA1592
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA017732
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA017732, RRID:AB_1847395
Product name
Anti-CNNM4 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA017732
Antibody type
Polyclonal
Antigen
Metal transporter CNNM4 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
FSYYGTMALTSVPSDRSPAHPTPLSRSASLSYPDR
TDVSTAATLAGSSNQFGSSVLGQYISDFSVRALVD
LQYIKITRQQYQNGLLASRMENSPQFPIDGCTTHM
ENLAEKSELPVVDETTTLLNERNSL
Storage
-20C
Provider Type Product Number
- No reagents -