HPA017732

CNNM4 antibody from Atlas Antibodies
ACDP4, KIAA1592
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA017732
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA017732, RRID:AB_1847395
Product name
Anti-CNNM4
Provider product page
Atlas Antibodies - HPA017732
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
FSYYGTMALTSVPSDRSPAHPTPLSRSASLSYPDR
TDVSTAATLAGSSNQFGSSVLGQYISDFSVRALVD
LQYIKITRQQYQNGLLASRMENSPQFPIDGCTTHM
ENLAEKSELPVVDETTTLLNERNSL
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -