SAB2100455

CNNM4 antibody from Sigma-Aldrich
ACDP4, KIAA1592
No application information provided.

Antibody data

Product number
SAB2100455
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#SAB2100455, RRID:AB_10605266
Product name
Anti-CNNM4 antibody produced in rabbit
Provider product page
Sigma-Aldrich - SAB2100455
Antibody type
Polyclonal
Antigen
Peptide region of the protein sequence according to NP_064569.
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
LLASRMENSPQFPIDGCTTHMENLAEKSELPVVDE
TTTLLNERNSLLHKA
Storage
-20C
Provider Type Product Number
- No reagents -