HPA022255

ZNF276 antibody from Atlas Antibodies
CENP-Z, CENPZ, MGC45417, ZADT, ZFP276, ZNF477
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA022255
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA022255, RRID:AB_1859025
Product name
Anti-ZNF276
Provider product page
Atlas Antibodies - HPA022255
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
PWDKETAPRLPQHRGWNPGDAPQTSQGRGTGTPVG
AETKTLPSTDVAQPPSDSDAVGPRSGFPPQPSLPL
CRAPGQLGEKQLPSSTSDDR
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -