HPA021309

ZNF276 antibody from Sigma-Aldrich
CENP-Z, CENPZ, MGC45417, ZADT, ZFP276, ZNF477
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA021309
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA021309, RRID:AB_1859024
Product name
Anti-ZNF276 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA021309
Antibody type
Polyclonal
Antigen
Zinc finger protein 276 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
VKDEFSDLSEGDVLSEDENDKKQNAQSSDESFEPY
PERKVSGKKSESKEAKKSEEPRIRKKPGPKPGWKK
KLRCEREELPTIY
Storage
-20C
Provider Type Product Number
- No reagents -