HPA022255

ZNF276 antibody from Sigma-Aldrich
CENP-Z, CENPZ, MGC45417, ZADT, ZFP276, ZNF477
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA022255
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA022255, RRID:AB_1859025
Product name
Anti-ZNF276 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA022255
Antibody type
Polyclonal
Antigen
Zinc finger protein 276 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
PWDKETAPRLPQHRGWNPGDAPQTSQGRGTGTPVG
AETKTLPSTDVAQPPSDSDAVGPRSGFPPQPSLPL
CRAPGQLGEKQLPSSTSDDR
Storage
-20C
Provider Type Product Number
- No reagents -